DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10384 and khdrbs3

DIOPT Version :9

Sequence 1:NP_001163254.2 Gene:CG10384 / 37567 FlyBaseID:FBgn0034731 Length:492 Species:Drosophila melanogaster
Sequence 2:XP_009296555.1 Gene:khdrbs3 / 101867535 ZFINID:ZDB-GENE-130530-892 Length:305 Species:Danio rerio


Alignment Length:146 Identity:77/146 - (52%)
Similarity:101/146 - (69%) Gaps:13/146 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 KFNFVGKLLGPKGNSMKRLQEDTMCKMAVLGRGSMRDRRKEEELRGSGDSRYAHLFEDLHVEIST 111
            :||||||||||:|||:|||||||:.||::||:|||||:.||||||.||:::|.||.|||||.|..
Zfish    33 QFNFVGKLLGPRGNSLKRLQEDTLTKMSILGKGSMRDKEKEEELRKSGETKYHHLNEDLHVLIEV 97

  Fly   112 FAAPAEAHARIAYALAEVRRFLVPDYHDDIRQEQMWEMQALTSTPALGAHSLEDSHSPTINSSSQ 176
            ||.||||:||:.:||.|:::||:|||:|:|||.|:.|:..|..       ..||:..|...    
Zfish    98 FAPPAEAYARMGHALEEIKKFLIPDYNDEIRQAQLQELTYLNG-------GSEDAKVPAAR---- 151

  Fly   177 VGGTTNSSSNGASGRG 192
              |.|.:...|.|..|
Zfish   152 --GKTTTRGRGTSAPG 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10384NP_001163254.2 SF1_like-KH 44..155 CDD:239088 69/107 (64%)
khdrbs3XP_009296555.1 SF1_like-KH 34..141 CDD:239088 69/113 (61%)
Sam68-YY 227..279 CDD:293176
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170590096
Domainoid 1 1.000 84 1.000 Domainoid score I8227
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1012406at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm26159
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.