DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and F58G6.8

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001023246.2 Gene:F58G6.8 / 3565898 WormBaseID:WBGene00010278 Length:162 Species:Caenorhabditis elegans


Alignment Length:101 Identity:22/101 - (21%)
Similarity:46/101 - (45%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 FVRSLRQFLNQTSLHGLKFVGDS----GLSSWERSFFLGSFVTALIITVHLISNIYVKWDSTPVI 82
            |...|:.:....::||:..:..:    .:..|  |..|   :.:.:..|::..:|...:.:..|:
 Worm    53 FKNHLKNWGETATIHGVPHMAQAHTVIAIIVW--SIIL---IVSAVAFVYMFYSIAASYLAFNVV 112

  Fly    83 IGISPQATSILKVPFPAITICNMNQVQRSLVANYRE 118
            :.::   |.:...|||:||.||.|..:.|.:.|..|
 Worm   113 VNLN---TGLDSEPFPSITFCNTNPYKLSEMVNVPE 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 20/95 (21%)
ASC 29..499 CDD:279230 20/94 (21%)
F58G6.8NP_001023246.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162355
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.