DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and egas-4

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_501207.2 Gene:egas-4 / 3564809 WormBaseID:WBGene00018906 Length:883 Species:Caenorhabditis elegans


Alignment Length:335 Identity:65/335 - (19%)
Similarity:118/335 - (35%) Gaps:78/335 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   195 GLCCVFNFQPPEYLYKPFANNNRNLTNSDGFESVMWDPESGYPEQL-------PPKFYPATASGT 252
            |.|..||.....:.|:.                    ..||||..|       ..::.|.|.: .
 Worm   610 GNCFTFNHMNSSFKYEA--------------------RSSGYPGGLEMQMNVKQDEYLPWTET-A 653

  Fly   253 GITLGFTAVLDAEMGEYYCSSTNGPGFKVYFHNPIEVPKVKEAGLISAIGYETNYRIEMVRAEAV 317
            |:.: ||:..:..:..........|    :|.:.|.:.:|....|....|         |...:|
 Worm   654 GVMV-FTSTKEEAVTSESVRINTAP----HFESRIAINRVDYYRLGGRYG---------VCINSV 704

  Fly   318 PAIRSISRDGRQCLFKNEKELIFYRIYTRLNCENECLAAFLYDTCSCIPFDHPLIYSNASICSMG 382
            ..::|...||.               ||...|...|....:...|.|:...:|:.....| ||:.
 Worm   705 SEVKSYYYDGD---------------YTTDGCLRSCYQDVVNGDCGCMDPRYPMPNDGIS-CSIS 753

  Fly   383 DTSCVRRAQRASNRPG-WAKCRQQCLPSCFDLNYLASGFSFPLASNNFQLANALVESFNKSYLSK 446
            ..:|:.....:...|. |.:|  .|...|....|.:.....|       ..|.:|:. .::|.:|
 Worm   754 QKTCIDELVDSRGDPSTWPEC--TCPLPCSQTVYTSKLSRLP-------YVNKIVDC-EEAYTNK 808

  Fly   447 --------NIAVINVYFRESVYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFLILK 503
                    :..::.:...:..|...::...:.||:|:|.:||::.:.:|.|::|..| |:||.::
 Worm   809 TACYETFLDSVILRISLPKLDYMIYSETPAMDLTKFMSYLGGILSILIGVSIVSFVE-LFFLFVQ 872

  Fly   504 PLAELFVWKR 513
            .:..|...||
 Worm   873 LIVILLFNKR 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 60/319 (19%)
ASC 29..499 CDD:279230 60/319 (19%)
egas-4NP_501207.2 EGF 101..131 CDD:278437
EGF_CA 482..522 CDD:238011
ASC <610..869 CDD:279230 60/320 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.