DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and ppk17

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_001285988.1 Gene:ppk17 / 35006 FlyBaseID:FBgn0032602 Length:431 Species:Drosophila melanogaster


Alignment Length:551 Identity:105/551 - (19%)
Similarity:174/551 - (31%) Gaps:195/551 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 FLGSFVTALIITVHLISNIYVKWDSTPVIIGISPQATSILK--VPFPAITICNMNQVQRSLVANY 116
            :|..|...:::.|.|. ..:.|..:.|    ||..:...|.  :..|::|||.....:..::...
  Fly    21 YLVLFACCIVVIVQLY-ECFAKLYNPP----ISTHSYYSLNETIEMPSVTICREPPYKEEVLTRL 80

  Fly   117 REGSNESALLKLLCESDSWESSEADEEFSASNFVTNNLKISEFVSNHSQSCERMLLFCRFSA--- 178
            ..|:         |....:.:......|       ..:.:.||..|.:.......:|...:.   
  Fly    81 SGGA---------CPHPKYATCWMKYPF-------GEISLDEFFENSTHDSGDTFVFYGLNEDKN 129

  Fly   179 -VERNCSQLFQQILTDEGLCCVFNFQPPEYLYKPFANNNRNLTNSDGFESVMWDPESGYPEQLPP 242
             |..|.|..|..     |.|  :..:|.|        :.:.::.:.|: |:|.:.          
  Fly   130 NVVMNSSLHFYM-----GRC--YTLRPKE--------SAKRVSKAVGY-SIMLEH---------- 168

  Fly   243 KFYPATASGTGITLGFTAVLDAEMGEYYCSSTNGPGFKVYFH----NPIEVPKVKEAGLISAIGY 303
                        ::..|:|.|.:.|..        |:.|:.|    |..|: .:|.:|.:..:..
  Fly   169 ------------SMLTTSVSDVDTGSV--------GWHVFIHDKKENFTEI-NMKGSGRVEYVFV 212

  Fly   304 ETNYRIEM-----------VRAEAVPAIRSISRDGRQCLFKNEKELIFYRIYTRLNCENECLAAF 357
            ..|..||:           .|.||      .|.|..               |:.|.|..:|:...
  Fly   213 GVNEEIEIKLQTQYFSNVQTREEA------CSDDEN---------------YSDLKCGEQCIWQD 256

  Fly   358 LYDTCSCI-PFDHPL--------------------IYSNASICSMGDTSCVRRAQRASNRPGWAK 401
            |.|...|. |:.|.:                    :|.|..     |..|              .
  Fly   257 LADNMQCSGPWMHEIASEPCNDSLSMRKLISDYKDVYENED-----DFDC--------------D 302

  Fly   402 CRQQC---LPSCFDLNYLASGFSFPLASNNFQLANALVESFNKSYLSKNIAVINVYFRESVYYGN 463
            |.|.|   :.:.|..|..|  |:.|.......:          .|.:|.|::|    .|...|..
  Fly   303 CVQPCQSRIYTTFIQNRKA--FNQPEPRTQIYI----------YYTTKLISMI----EERPSYDT 351

  Fly   464 TKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFLILKPLAELFVW---KRSSHVDSEKSLKH 525
                    |:|:::|||.:|..:|.||:.|..||..::|     .|..   ||....:..| |:.
  Fly   352 --------TQFIADVGGSLGFLLGLSVLGLIGILEHMML-----FFCGGFIKRMQQKEQAK-LEA 402

  Fly   526 NAFGIEKGQSS------DNPSFWHSKELYPK 550
            |:   |.|||.      |....:..||..||
  Fly   403 NS---EDGQSQTSDETIDVEIAYKKKEKQPK 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 89/489 (18%)
ASC 29..499 CDD:279230 89/489 (18%)
ppk17NP_001285988.1 ASC 11..358 CDD:295594 79/468 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456728
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.