DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and ppk14

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_609017.2 Gene:ppk14 / 33887 FlyBaseID:FBgn0031803 Length:504 Species:Drosophila melanogaster


Alignment Length:536 Identity:116/536 - (21%)
Similarity:196/536 - (36%) Gaps:130/536 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 FLNQTSLHGLKFVGDSGLSSWERSFFLGSFVTALIITVHLISNIYVKWDSTPVIIGISPQATSIL 93
            :::::.:|||..:....:....|..:..:.:.|..:..|:...:..::.:......::....||.
  Fly    45 YISRSHIHGLYLLFLPSMRRRMRVLWALALICACTVLFHVSYLLGDRYHNKQFQTIVAHAHASIH 109

  Fly    94 KVPFPAITICNMNQVQRSLVANYRE-----GSNESALLKLLCESDSW---ESSEADEEFSASNFV 150
            .:.||.:.|||.|::..|.:...:.     .|.:....::|...|.:   :.:..|.....|...
  Fly   110 HIAFPVVIICNKNRLNWSRLPEIKSLYNITPSQDELFDRILTAYDGFSFHKFNAFDSLLGESLDE 174

  Fly   151 TNNLKISEFVSNHSQSCERMLLFCRFSAVERNCSQLFQQILTDEGLCCVFNFQPPEYLYKPFANN 215
            .|:|..:|.|...|..|:.:|..|.:....|:|.:||:......|.|..||              
  Fly   175 LNHLNFTEIVIQMSWRCDEILRDCHWQTASRDCCKLFRPRRLPLGYCLAFN-------------- 225

  Fly   216 NRNLTNSDGFESVMWDPESGYPEQLPPKFYPATASGTGITLGFTAVLDAEMGEYYCSSTNGPGF- 279
              .|....|.|                         |||..|....|....|::...::...|| 
  Fly   226 --ELEKRRGTE-------------------------TGINTGLLLRLLLREGQHAPGNSGLKGFW 263

  Fly   280 ------KVYFHNPIE-VPKVKEAGLISAIGYETNYRIEMVRAEAVPAIRSISRDGRQCLFKNEKE 337
                  .|:|..||| ||..:           ||..:..|......:..|:....|.|:...|:|
  Fly   264 LTVVESSVWFGFPIEVVPHSR-----------TNVAVTAVYHYFDESTLSLPSSWRHCVMDYEEE 317

  Fly   338 LIFYRI-----YTRLNCENECLAAFLYDTCSCIPFDHPLIY--SNASICSMGDTSCVRRAQRASN 395
            ...:|.     |...||:.||...:|...|:|..   .|.|  ||...|.:.|..|:    .|.|
  Fly   318 SEHFRTLEGQKYMLENCQAECQQRYLLRYCNCTV---DLFYPPSNYPACRLKDLPCL----AAHN 375

  Fly   396 -------RPG----------WAKCRQQCLPSCFDLNYLASGFSFPLASNNFQLANALVESFNKSY 443
                   :||          ...|  :||.:|..|..|..                :.:|..:.:
  Fly   376 HLLQNFEQPGEHPYVHREESGLVC--ECLHNCKSLTLLTD----------------MRKSVQQPW 422

  Fly   444 LSKNIAVI-----NVYFRES---VYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFL 500
            |..|.:.|     ||||::.   ||..|....:|.|   :.:.||:..|.:|.|:|||.|.::|.
  Fly   423 LQPNSSAIESMWLNVYFKKPSMLVYKTNLIYTWVDL---IVSFGGICQLCLGCSIISLIEFVFFA 484

  Fly   501 ILKPLAELFVWKRSSH 516
            :.| :.:|: |:|.|:
  Fly   485 LYK-VPQLY-WERFSN 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 110/517 (21%)
ASC 29..499 CDD:279230 110/517 (21%)
ppk14NP_609017.2 ASC 45..483 CDD:279230 110/517 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm14782
orthoMCL 1 0.900 - - OOG6_100105
Panther 1 1.100 - - P PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.