DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and asic-1

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_491214.3 Gene:asic-1 / 191422 WormBaseID:WBGene00022815 Length:823 Species:Caenorhabditis elegans


Alignment Length:413 Identity:91/413 - (22%)
Similarity:152/413 - (36%) Gaps:103/413 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 LCESDSWESSEADEEFSASNFVTNNLKISEFVSNHSQSCERMLLFCRFSAVERNCSQLFQQILTD 193
            |.|.:.|:.|     ::.|:|:                     :.|.|:..|.|....|.:.|..
 Worm   475 LTEEEKWKIS-----YNKSDFI---------------------MKCSFNGRECNVKHDFVEYLDP 513

  Fly   194 E-GLCCVFNFQPPEYLYKPFANNNRNLTNSDGFESVMWDPESGYPEQLPPKFYPATASGTGITLG 257
            . |.|         :.|.....||.|                   |:..|.:        |:.|.
 Worm   514 TYGAC---------FTYGQKLGNNTN-------------------ERSGPAY--------GLRLE 542

  Fly   258 -FTAVLDAEMGEYYCSSTNGPGFKVYFHNPIEVPKVKEAGLISAIGYETNYRIEMVRAEAVPA-I 320
             |..|.:      |..:|...|.::..|...|.|.....|..:..|:.:::.|::.....:|| .
 Worm   543 VFVNVTE------YLPTTEAAGVRLTVHATDEQPFPDTLGFSAPTGFVSSFGIKLKSMVRLPAPY 601

  Fly   321 RSISRDGRQCLFKNEKELIFYRIYTRLNCENECLAAFLYDTCSC-IPFDHPLIYSNASICSMGD- 383
            ....|:|     |.|..:...:.|....|:..|:...|..||.| .|...|  |..:..|.:.| 
 Worm   602 GDCVREG-----KTEDFIYTQKAYNTEGCQRSCIQKHLSKTCGCGDPRFPP--YRESKNCPVDDP 659

  Fly   384 --TSCVRR----AQRASNRPGWAKCRQQCLPSCFDLNYLASGFSFPLASNNFQ---LANALVESF 439
              ..|::.    |.|.|.:.| ..|:|.|....:.::|.||  .:|..:.:..   |..|.....
 Worm   660 YKRECIKNEMHVATRDSKKLG-CSCKQPCNQDVYSVSYSAS--RWPAIAGDLSGCPLGMAAHHCL 721

  Fly   440 NKSYLSKNIAVINVYFRESVYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFLILKP 504
            |  |..:..::|.|||.:..|....::...|.:..||:.||.:||:||.|||::.|:..|..   
 Worm   722 N--YKREQGSMIEVYFEQLNYESLLESEAYGWSNLLSDFGGQLGLWMGVSVITIGEVACFFF--- 781

  Fly   505 LAELFVWKRSSHVDSEKSLKHNA 527
              |:|:    |.:.|.::.:..|
 Worm   782 --EVFI----SLISSNRTKRRPA 798

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 85/383 (22%)
ASC 29..499 CDD:279230 85/383 (22%)
asic-1NP_491214.3 deg-1 16..779 CDD:273309 85/383 (22%)
ASC 17..>104 CDD:279230
ASC <469..788 CDD:295594 89/401 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 106 1.000 Domainoid score I4100
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 107 1.000 Inparanoid score I3493
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100105
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X60
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.770

Return to query results.
Submit another query.