DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and del-5

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_509838.2 Gene:del-5 / 186631 WormBaseID:WBGene00010334 Length:526 Species:Caenorhabditis elegans


Alignment Length:247 Identity:45/247 - (18%)
Similarity:82/247 - (33%) Gaps:85/247 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 YCSSTNGPGFKVYFHNPIEVPKVKEAGLISAIGYETN--------YRIEMVRAEAVPAIRSISRD 326
            ||.|       :.|....:: ::|:.||....|.|.:        :...|:|.:.:...|  ...
 Worm   161 YCVS-------IRFSTKTKI-RLKKKGLYFKHGTEEDVHYLSSKPHTHHMIRLKLIQIDR--LNL 215

  Fly   327 GRQCLFKNEKELIF--------YRIYTRLNCENECLAAFLYDTCSCIPFDHPLIYSNASICSMGD 383
            ||.....|.:|:.:        || |:...|||  :...|......:.:|.|             
 Worm   216 GRAPCTTNWREITWIEKDSIPDYR-YSLNMCEN--IRFELTRKVEYLQYDFP------------- 264

  Fly   384 TSCVRRAQRASNRPGWAKCRQQCLPSCFDLNYLASGFSFPLASNNFQLANALVESFNKSYLSKNI 448
                                  |.|||.::.|..|......:|::..:..:::.:......::..
 Worm   265 ----------------------CYPSCSEIKYQVSKSKLRHSSDSVVITFSVLPTITLMQETRKT 307

  Fly   449 AVINVYFRESVYYGNTKNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFL 500
            .:|::                     |..:||...||||.|.::|.|:..||
 Worm   308 TLIDI---------------------LCYLGGASSLFMGCSCVTLMEMFVFL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 43/244 (18%)
ASC 29..499 CDD:279230 43/244 (18%)
del-5NP_509838.2 ASC 66..337 CDD:295594 43/244 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.