DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and del-6

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:NP_741622.2 Gene:del-6 / 179474 WormBaseID:WBGene00011891 Length:577 Species:Caenorhabditis elegans


Alignment Length:226 Identity:43/226 - (19%)
Similarity:86/226 - (38%) Gaps:49/226 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   345 TRLNCENECLAAFLYDTCSCIPFDHPLIY----SNASICSMGD-TSCVRRAQRASNRPGWAKCRQ 404
            :..||.:.|....:.|.|.|.|..  |.|    .:..|..:.| |.|....|:.:...  .:|..
 Worm   347 SEFNCRSRCRMEMIRDACHCTPLS--LSYLAKKEDMEIFPLCDYTQCTVDVQKGNYSD--TECAN 407

  Fly   405 QCLPSC----FDLNYLASGFSFPLASNNFQLANALVESFNKSYLSKNIAVINVYFRESVYYGNTK 465
            :|.|.|    |::::...|                      ..|..::.::.:.:....|....:
 Worm   408 KCFPDCRQIRFEVDHSVKG----------------------RMLRPDLTLVELSWGPFEYLTMEQ 450

  Fly   466 NAYVGLTEFLSNVGGVMGLFMGFSVISLAEIL---YFLILKPLAELFVWKRSSHVD-SEKSLKHN 526
            ......|.|::.:||.:|:::|.|::||.:::   |....|.:....:.|:.:..| .::..:..
 Worm   451 QWKYSATSFIAALGGSIGMWLGLSILSLIQLVTYSYTYFTKKIVNERILKKGNTFDKKDEGDEDG 515

  Fly   527 AFGIEKGQS------SDNPSFWHSKELYPKG 551
            .|.|:.|..      ::||    ..|.:|.|
 Worm   516 DFTIDNGTERKKMSLAENP----FAEFFPAG 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 31/165 (19%)
ASC 29..499 CDD:279230 31/165 (19%)
del-6NP_741622.2 ASC <347..484 CDD:295594 31/162 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.