DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and GPRGR26

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_309026.1 Gene:GPRGR26 / 1270341 VectorBaseID:AGAP006717 Length:445 Species:Anopheles gambiae


Alignment Length:101 Identity:25/101 - (24%)
Similarity:34/101 - (33%) Gaps:22/101 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   404 QQCLPSCFDLNYLASGFSFPLASNNFQLANALVESFNKSYLS----KNIAVINVYFRESVYYGNT 464
            :|.|....||:.......||.....|....|.:..|....|:    .|..|:..:.|.|..|   
Mosquito   123 EQLLAVAVDLSLCGGTVDFPRIETIFNRVLACIALFFAGVLTVDLLYNDLVVWRFARSSAVY--- 184

  Fly   465 KNAYVGLTEFLSNVGGVMGLFMGFSVISLAEILYFL 500
                     .||||..|:.|      :..|.:||.|
Mosquito   185 ---------TLSNVINVLAL------LQYAYVLYVL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 23/98 (23%)
ASC 29..499 CDD:279230 23/98 (23%)
GPRGR26XP_309026.1 7tm_7 21..415 CDD:285581 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.