DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and mybl1

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_002935365.2 Gene:mybl1 / 100491549 XenbaseID:XB-GENE-986560 Length:730 Species:Xenopus tropicalis


Alignment Length:237 Identity:54/237 - (22%)
Similarity:84/237 - (35%) Gaps:63/237 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KFVGDSGLSSWERSFFLGSFVTALIITVHLISNIYVKWDSTPVIIG--------ISPQATSILKV 95
            |.|.....|||..||.:...::..:  .||....| ..|..|:..|        ::|:|..:|: 
 Frog   285 KRVPSPSSSSWIDSFSVEESMSNTV--THLEEQTY-SLDEIPITSGQQSVKEKILAPEANIVLQ- 345

  Fly    96 PFPAITICNMNQVQRSLVANYREGSNESALLKLL-CESDSWESSEADE--EFSASNFVTNNLKIS 157
              |..||...::.                 |:|: .:|..|.:.|..|  .|.||...:..||..
 Frog   346 --PLGTIPEFSET-----------------LELIDVDSVDWNNFENCELPFFLASPAKSTPLKWI 391

  Fly   158 EFVSNHSQSCERMLLFCRFSAVERNCSQLFQQILTDEGLCCVFNFQPPEYLYKPFANNNRNLTNS 222
            :.  .|..|.:..|..| ....:..||.  .::|:.......| :.||..|.|...:.:.:||  
 Frog   392 QV--QHGNSPDWALNSC-LGQADGRCSA--SRVLSSSPAMPKF-YSPPAILRKKKLHPDLSLT-- 448

  Fly   223 DGFESVMWDPES---------GYP-EQLP--PKFYPATASGT 252
                     ||:         |.| ::||  |.......|||
 Frog   449 ---------PEARDAGNVVLKGTPVKKLPYSPSQLLNVCSGT 481

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 54/237 (23%)
ASC 29..499 CDD:279230 54/237 (23%)
mybl1XP_002935365.2 Myb_DNA-bind_6 38..97 CDD:372817
PLN03091 83..>191 CDD:215570