DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and slc6a3

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_002933174.1 Gene:slc6a3 / 100488824 XenbaseID:XB-GENE-982873 Length:621 Species:Xenopus tropicalis


Alignment Length:118 Identity:26/118 - (22%)
Similarity:43/118 - (36%) Gaps:45/118 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 CFDLNYLASGFSFPLASNNFQLANALVESFNKSYLSKNIAVINVYFRESVYYGNTKNAYVGLTEF 474
            ||.|..   ||...:|          ..|:||        ..|..:|:::...:..:    ||.|
 Frog   320 CFSLGV---GFGVLIA----------FSSYNK--------FTNNCYRDAIITTSVNS----LTSF 359

  Fly   475 LSNVGGVMGLFMGFSV----ISLAEI------LYFLILK------PLAELFVW 511
            .|  |.|:..|:|:..    :.:.::      |.|:|..      ||:.  ||
 Frog   360 FS--GFVIFSFLGYMAQKHNVPIGDVAKDGPGLIFIIYPEAIATLPLSS--VW 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 20/98 (20%)
ASC 29..499 CDD:279230 20/98 (20%)
slc6a3XP_002933174.1 SLC6sbd_DAT1 60..615 CDD:212083 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.