DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk12 and abhd18

DIOPT Version :9

Sequence 1:NP_611672.1 Gene:ppk12 / 37566 FlyBaseID:FBgn0034730 Length:569 Species:Drosophila melanogaster
Sequence 2:XP_012819976.1 Gene:abhd18 / 100124957 XenbaseID:XB-GENE-5793289 Length:461 Species:Xenopus tropicalis


Alignment Length:265 Identity:53/265 - (20%)
Similarity:91/265 - (34%) Gaps:68/265 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   234 SGYPEQLP--PKFYPATASG---TGITLGFTAVLDAEMGEYYCSST-------------NGPGFK 280
            :.:|:.:|  |....:||||   ||:.  ..||...|:.:.||:.|             ....||
 Frog   210 TNWPKPIPLVPCLSWSTASGVFTTGVL--SKAVNWRELEKQYCTQTVYEEEIIHLLEYCGTDSFK 272

  Fly   281 V----YFHNPIEVPKVKEAGLISAI----GYETNYRIE--------------MVRAEAVPAIRSI 323
            :    ..::|..:..:....|.|.|    |...::..|              |.::::..:|...
 Frog   273 MGQDFVKNSPRSLDSLAHLNLASDIFDFKGTRDSFSAEPVQPFHASNNANGLMFQSDSKISIIGQ 337

  Fly   324 SRDGRQCLFKNEKELIFYRIYTRLNCENECL--AAFLY-----DTCS-----CIPFDHPLIYSNA 376
            ...|:..:..|....:......:.|..||.|  .:||:     |.|:     .:|.|..||.   
 Frog   338 EPPGKNVISSNPGSPLGLGSMRKENKRNEALQRESFLFMKGVMDECTHVGNFSVPVDPSLII--- 399

  Fly   377 SICSMGDTSCVRRAQRASNRPGWAKCRQQCLPSCFDLNYLASGFSFPLASNNFQLANALVESFNK 441
             :....:.:.|.|.........|        |.| ::.||..|..............|:.::||:
 Frog   400 -VVQAKEDAYVPRTGVRGLHEIW--------PGC-EIRYLEGGHISAYLFKQGLFRQAIYDAFNR 454

  Fly   442 SYLSK 446
             ||.|
 Frog   455 -YLQK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk12NP_611672.1 deg-1 28..499 CDD:273309 53/265 (20%)
ASC 29..499 CDD:279230 53/265 (20%)
abhd18XP_012819976.1 DUF2048 16..454 CDD:370661 49/258 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165170757
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.