DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and PFA4

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:206 Identity:53/206 - (25%)
Similarity:85/206 - (41%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 TFTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVEPPSDQLNWRE-CGECQKLAPPRSWHCKACKV 112
            ||.|.::|..:     :....:..:....:...:||.|  .||. |.:||...|.||.|||.|..
Yeast    42 TFEFCLSMIWL-----SYYLAICTNPGRPLPNYKPPPD--IWRNFCKKCQSYKPERSHHCKTCNQ 99

  Fly   113 CILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLAC 177
            |:|..||||.:|..|:|..|:..|:.|:|::       :|..|:...:....||..|        
Yeast   100 CVLMMDHHCPWTMNCVGFANYPHFLRFLFWI-------IVTTSVLFCIQAKRIYFIW-------- 149

  Fly   178 PMLHLVTGSFWTNMYLVFYSL-----NILALAYGVLLLAYHVPIVLRGGVSADRTKESKEKYDRG 237
            ...|| .|.|:....|:|.::     :.:.|...:|.|......:|.|       :...|.:|  
Yeast   150 QQRHL-PGYFFKKSELIFLTISSPLNSFVLLTITILFLRCLFNQILNG-------RSQIESWD-- 204

  Fly   238 VYQNLRSVFGN 248
             ...|.|:|.:
Yeast   205 -MDRLESLFNS 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/131 (29%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 53/206 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.