DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT4G24630

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_194194.2 Gene:AT4G24630 / 828565 AraportID:AT4G24630 Length:407 Species:Arabidopsis thaliana


Alignment Length:291 Identity:62/291 - (21%)
Similarity:110/291 - (37%) Gaps:97/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTS-----VNVK 79
            ::.:.:||| :|.:.|.....||...:...:. :|.:.::|.|   .:..::..||     :..:
plant    34 LLLIIVPVV-LFCVFVARHLRHEFSPYNAGYA-IMVVAILFTI---YVLILLFFTSARDPGIVPR 93

  Fly    80 KVEPPSDQLNW-------------------------------RECGECQKLAPPRSWHCKACKVC 113
            ...||.:.|.:                               :.|..|....|||..||..|..|
plant    94 NSHPPEEDLRYETTVSADGRQTPSVQIPRTKEVIVNGVSVRVKYCDTCMLYRPPRCSHCSICNNC 158

  Fly   114 ILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGS-----VYALVYNSIYMWVIHGHIY------- 166
            :.:.||||.:.|.||||||:|:     |::||.|     :|....:::|:.::..|..       
plant   159 VERFDHHCPWVGQCIGLRNYRY-----FFMFVSSSTLLCIYIFSMSAVYIKILMDHQQATVWRAM 218

  Fly   167 --SNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSADRTKE 229
              |.|..||.:.|                      .:||.:...|.|:|:.:     :|.::|..
plant   219 KESPWAVVLMIYC----------------------FIALWFVGGLTAFHLYL-----ISTNQTTY 256

  Fly   230 SKEK----------YDRGVYQNLRSVFGNRM 250
            .|.:          |:||...|...||.:::
plant   257 EKLRYRSSHSRSIVYNRGCPNNFLEVFCSKV 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/140 (27%)
AT4G24630NP_194194.2 zf-DHHC 136..261 CDD:279823 41/156 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.