DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT4G00840

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_567193.2 Gene:AT4G00840 / 826193 AraportID:AT4G00840 Length:291 Species:Arabidopsis thaliana


Alignment Length:176 Identity:49/176 - (27%)
Similarity:86/176 - (48%) Gaps:24/176 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIY 157
            |.:|:.:.|||..||..|:.|:||.||||::...|:|.||::||:.|:||.|:.::..::.    
plant   113 CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIV---- 173

  Fly   158 MWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAY---HVPIVLR 219
                   :..:::.....|  :.|..:.....::.|.|    :|..|:.:.||.:   |:.::..
plant   174 -------LLPSFIEFFSQA--IKHSSSPGKLASLVLAF----VLNFAFVLSLLCFVVMHISLLSS 225

  Fly   220 GGVSA---DRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRSD 262
            ...|.   ::..|.:.|||.|..:|...|||.:... ||.||...|
plant   226 NTTSVEVHEKNGEVRWKYDLGKKKNFEQVFGKKKAF-WLLPLYSKD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/129 (26%)
AT4G00840NP_567193.2 zf-DHHC 4..266 CDD:303066 46/170 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.