DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT3G56930

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_191252.1 Gene:AT3G56930 / 824860 AraportID:AT3G56930 Length:477 Species:Arabidopsis thaliana


Alignment Length:283 Identity:61/283 - (21%)
Similarity:117/283 - (41%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSRMVDILCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTF----------TFLMAMFLVFNIK 63
            |:..:.|||...|...|.:.|:     ::.:..:||....:|          :...:|..|....
plant    66 PNLCIPILCVSWILTILDIFFL-----LMTSSRDPGIVPRSFRPPETDDAPDSTTPSMEWVSGRT 125

  Fly    64 GNMIACMMIDTSVNVKKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCI 128
            .|:....:.|.:||...|:.       :.|..|....|||:.||..|..|:.:.||||.:.|.||
plant   126 PNIRIPRVKDVTVNGHTVKV-------KFCDTCLLYRPPRASHCSICNNCVQRFDHHCPWVGQCI 183

  Fly   129 GLRNHRFFMGFIFYLFVGSVYAL-VYNSIYMW--VIHGHI---YSNWVTVLKLACPMLHLVTGSF 187
            |:||:||     |::|:.:...| :|...:.|  :...|:   .|.|..:.|           ..
plant   184 GVRNYRF-----FFMFISTSTTLCIYVFAFSWLNIFQRHMDEKISIWKAISK-----------DV 232

  Fly   188 WTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSAD----RTKESKEKYDRGVYQNLRSVFGN 248
            .:::.:|:..:.:..:..   |..:|..::.....:.:    |..:.:..|::|:..|:..:|  
plant   233 LSDILIVYCFITVWFVGG---LTIFHSYLICTNQTTYENFRYRYDKKENPYNKGILGNIWEIF-- 292

  Fly   249 RMHLAWLSPLI---RSDLPEDGY 268
               |:.:.|.:   ||.:.|:.|
plant   293 ---LSKIPPSMNKFRSFVKEEDY 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 33/132 (25%)
AT3G56930NP_191252.1 DHHC 146..271 CDD:396215 33/143 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.