DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT3G48760

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_190445.2 Gene:AT3G48760 / 824037 AraportID:AT3G48760 Length:476 Species:Arabidopsis thaliana


Alignment Length:284 Identity:66/284 - (23%)
Similarity:106/284 - (37%) Gaps:77/284 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SRMVDILCFLIIAVFLPVVFMFEIVV---VLPAF--HEPGGFFHTFTFLMAMFLVFNIKGNMIAC 69
            :|.:.|..|||.|   ||: :|.|.|   .:..|  |...........|:.:.|||     ::..
plant    51 ARSILITVFLITA---PVI-VFCIFVGRKFIDDFPHHRGVSVLAVAVGLILLDLVF-----LLLT 106

  Fly    70 MMIDTSVNVKKVEPPSDQLN------------------------------WRECGECQKLAPPRS 104
            ...|..:..:.:.||..:.|                              .:.|..|....|||:
plant   107 SARDPGIIPRNLYPPEPESNEGNGEPRLAHTPQSRLPRTKDMIVNGITVKIKYCDTCMLYRPPRA 171

  Fly   105 WHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSN- 168
            .||..|..|:.|.||||.:.|.||||||:||:  |:|.|.  |....:|..::.|:....|..: 
plant   172 SHCSICNNCVEKFDHHCPWLGQCIGLRNYRFY--FMFVLC--STLLCIYVHVFCWIYVKRIMDSE 232

  Fly   169 ----WVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSADRTKE 229
                |.:.||..            .::.|:.|:...:....|  |..:|:.::   ..:....:.
plant   233 NINIWKSFLKTP------------ASIALIIYTFICVWFVGG--LTCFHLYLM---STNQSTYEN 280

  Fly   230 SKEKYDR-------GVYQNLRSVF 246
            .:.:|||       |:..|...||
plant   281 FRYRYDRHENPFNKGIVGNFMEVF 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/131 (29%)
AT3G48760NP_190445.2 zf-DHHC 153..283 CDD:279823 38/150 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.