DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT3G26935

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_850638.1 Gene:AT3G26935 / 822311 AraportID:AT3G26935 Length:443 Species:Arabidopsis thaliana


Alignment Length:274 Identity:61/274 - (22%)
Similarity:109/274 - (39%) Gaps:68/274 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMI---DTSVN 77
            |...:|||.:.:..:|....::..|.:..|     ..::|:.:||.|. ::|..::.   |..:.
plant    47 LTICLIAVPVTIFCIFVARKLIDDFSDSWG-----VSIVAVAVVFTIY-DLILLLLTSGRDPGII 105

  Fly    78 VKKVEPPSD-------------------------QLNW-----RECGECQKLAPPRSWHCKACKV 112
            .:...||..                         |||.     :.|..|....|||..||..|..
plant   106 PRNAHPPEPETLDGNMDAGAGQTPQLRLPRIKEVQLNGITFKVKYCDTCMLYRPPRCSHCSICNN 170

  Fly   113 CILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYM-WVIHGHIYSNWVTVLKLA 176
            |:.:.||||.:.|.|||:||:|||..|:|...:..:|...:..:|: .::.....:.|..:||..
plant   171 CVERFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFAFCWVYIRKIMESEHTTTWKAMLKTP 235

  Fly   177 CPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSADRT--KESKEKYDR--- 236
                        .::.|:.|:...:....|  |..:|:.:     :|.::|  :..:.:|||   
plant   236 ------------ASIVLIIYTFISMWFVGG--LTVFHLYL-----ISTNQTTYENFRYRYDRRSN 281

  Fly   237 ----GVYQNLRSVF 246
                ||..|.:..|
plant   282 PHNKGVVNNFKETF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/127 (27%)
AT3G26935NP_850638.1 DHHC 149..274 CDD:396215 36/143 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.