DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT3G22180

DIOPT Version :10

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_188857.1 Gene:AT3G22180 / 821782 AraportID:AT3G22180 Length:706 Species:Arabidopsis thaliana


Alignment Length:86 Identity:23/86 - (26%)
Similarity:37/86 - (43%) Gaps:16/86 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KKVEPPSDQLNWRE---CGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFI 140
            ||..|..:|.|..|   |..|.......|.||::|..|:...||||.:...|:|.:|:..|:..:
plant   157 KKEGPAEEQGNSEEALFCTLCNCEVRKFSKHCRSCDKCVDCFDHHCKWLNNCVGRKNYVTFVSLM 221

  Fly   141 FYLFVGSVYALVYNSIYMWVI 161
                         ::..:|:|
plant   222 -------------SASLLWLI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 DHHC 93..220 CDD:396215 17/69 (25%)
AT3G22180NP_188857.1 DHHC 168..305 CDD:396215 18/75 (24%)

Return to query results.
Submit another query.