DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT3G18620

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_188492.2 Gene:AT3G18620 / 821393 AraportID:AT3G18620 Length:345 Species:Arabidopsis thaliana


Alignment Length:302 Identity:77/302 - (25%)
Similarity:122/302 - (40%) Gaps:87/302 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CFLII-AVFL------------PVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIA 68
            ||::| |||:            ||:|...:..         |.||:.|               .|
plant    67 CFVVILAVFMLFVICGGIWAAYPVLFSISLAC---------GIFHSVT---------------TA 107

  Fly    69 CMMIDT-----SVNVKKVEPPSDQL-------------NWRECGECQKLAPPRSWHCKACKVCIL 115
            .:.|.|     .|..|....|::.|             |:..|..|.|...||:.||:.|.:|:|
plant   108 TLAISTLSTFILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSPRTHHCRTCGMCVL 172

  Fly   116 KRDHHCIYTGCCIGLRNHRFFMGFIF-------YLFVGSVYALV-----------YNSIYMWVIH 162
            ..||||.:.|.|:|..||::|:.|:.       |..|..||.|:           |.|....|.|
plant   173 DMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASDVAHVAH 237

  Fly   163 GHIYSNWVTVLKLACPMLHLVTGSFWT--NMYLVFYSLNILALAYGV-LLLAYHVPIVLRG---- 220
            |:..| .:.|:|..| :.::....|.:  ::.||:..:..:::|.|: :||...:..:..|    
plant   238 GNSIS-ILRVVKNIC-LTYIANAVFISVRSLVLVYLFVASVSVAIGLSVLLWQQLSYIYEGKTYL 300

  Fly   221 -GVSADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRS 261
             .:|:..|:|..||..|    ||.:.||....:....|.||:
plant   301 SHLSSQGTEEDGEKSCR----NLLTFFGCPHSIERHLPTIRN 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 42/147 (29%)
AT3G18620NP_188492.2 DHHC 76..>219 CDD:418707 41/166 (25%)
DHHC 149..298 CDD:396215 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D863846at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.