DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and AT2G40990

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_181632.5 Gene:AT2G40990 / 818699 AraportID:AT2G40990 Length:411 Species:Arabidopsis thaliana


Alignment Length:286 Identity:75/286 - (26%)
Similarity:116/286 - (40%) Gaps:65/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LCFLIIAVFLPVVFMFEIVVVLPAFHE---PGGFFHT---FTFLMAMFLVFNIKGNMI------- 67
            |.|.|..|||       |....|.||.   .|....|   ||||   ||..:....:|       
plant    66 LTFCIRMVFL-------IGKRYPLFHSLILLGALLLTVLDFTFL---FLTSSRDPGIIPRNKEAP 120

  Fly    68 ---ACMMIDTS---VNVK----KVEPPSDQL------NWRECGECQKLAPPRSWHCKACKVCILK 116
               ...||..|   ||.|    |:....|.|      ..:.|..|....|||:.||..|..|:.:
plant   121 EAEGLDMITQSSEWVNNKLGNTKIPRTKDILVNGYTVKVKFCDTCLLYRPPRASHCSICNNCVQR 185

  Fly   117 RDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLH 181
            .||||.:.|.||.|||:.:|:.||....:..:|..|:              :||::|::...||.
plant   186 FDHHCPWVGQCIALRNYPYFICFISTSTLLCLYVFVF--------------SWVSMLEVHGKMLL 236

  Fly   182 LVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSAD----RTKESKEKYDRGVYQNL 242
            :|..:....:.|:.|...::....|  |..:|:.::.....:.:    |..:.:..|.:|:::||
plant   237 MVITNDLVFVVLILYCFVVVWFVGG--LTVFHLYLICTNQTTYENFRYRYDKKENPYGKGLFKNL 299

  Fly   243 RSVFGNRMHLAWLSPLI--RSDLPED 266
            ..:|..|:.    .|:|  |...||:
plant   300 YELFFARIP----PPMINFRDWAPEE 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/126 (28%)
AT2G40990NP_181632.5 DHHC 160..282 CDD:396215 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.