DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and ZDHHC14

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_016866796.1 Gene:ZDHHC14 / 79683 HGNCID:20341 Length:506 Species:Homo sapiens


Alignment Length:307 Identity:64/307 - (20%)
Similarity:107/307 - (34%) Gaps:110/307 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSV----- 76
            |.|....:|.|    :|...:||              :|..|.|.:.|.::.....|..|     
Human    96 CLLRSCPYLAV----KITPAIPA--------------VAGILFFFVMGTLLRTSFSDPGVLPRAT 142

  Fly    77 --------------------------NVKKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCIL 115
                                      ..|:|......:..:.|..|:...|||:.||..|..|:.
Human   143 PDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVE 207

  Fly   116 KRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPML 180
            :.||||.:.|.|:|.||:||     ||:|:.|:                   :::||...|..:.
Human   208 RFDHHCPWVGNCVGKRNYRF-----FYMFILSL-------------------SFLTVFIFAFVIT 248

  Fly   181 HLVTGSFWTNM--------------YLVFYSL-NILALAYGVLLLAYHVPIV---------LRGG 221
            |::..|..|..              .:.|:|: :|:.|:      .:|..::         ::|.
Human   249 HVILRSQQTGFLNALKDSPASVLEAVVCFFSVWSIVGLS------GFHTYLISSNQTTNEDIKGS 307

  Fly   222 VSADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRSDLPEDGY 268
            .|..|.||:...|..|      ::|.| ..:|...|:..|.:...||
Human   308 WSNKRGKENYNPYSYG------NIFTN-CCVALCGPISPSLIDRRGY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/150 (23%)
ZDHHC14XP_016866796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.