DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001347605.1 Gene:Zdhhc16 / 74168 MGIID:1921418 Length:377 Species:Mus musculus


Alignment Length:298 Identity:67/298 - (22%)
Similarity:119/298 - (39%) Gaps:57/298 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTF----TFLMAMFLVFNIKGNMIACMMIDTS 75
            :|..::....:.:.::..:.::|..:..|...:|.|    ..::.:|..:.             :
Mouse    85 VLVIVLTGSIVAIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQ-------------A 136

  Fly    76 VNVKKVEPP---SDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFM 137
            :......||   :|......|.:|....|.|:.||..|..|:||.||||.:...|:|..|||:|.
Mouse   137 ITTPPGYPPQGRNDIATVSICKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVGHYNHRYFF 201

  Fly   138 GFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFW-------------- 188
            .|.|::.:|.||. .|.|   |.:....|:....:.:|....|..:....:              
Mouse   202 SFCFFMTLGCVYC-SYGS---WDLFREAYAAIEKMKQLDKNKLQAIANQTYHQTPPPTFSFRERI 262

  Fly   189 TNMYLVF--YSLNILALAYGVLLLAYHVPIVLRGGVSADRTKESKEK-------------YDRGV 238
            |:..||:  :..:.:|||.|.|.: :|..::.||..|.:|....||:             |:.|.
Mouse   263 THKSLVYLWFLCSSVALALGALTM-WHAVLISRGETSIERHINKKERRRLQAKGRVFRNPYNYGC 326

  Fly   239 YQNLRSVFGNRMHLAWLSPLI--RSDLPE-DGYHWNVP 273
            ..|.:...|......||:.::  .|.||. :|..|:.|
Mouse   327 LDNWKVFLGVDTGRHWLTRVLLPSSHLPHGNGMSWDPP 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 40/142 (28%)
Zdhhc16NP_001347605.1 DHHC 156..305 CDD:396215 44/153 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.