DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_848482.1 Gene:Zdhhc2 / 70546 MGIID:1923452 Length:366 Species:Mus musculus


Alignment Length:193 Identity:53/193 - (27%)
Similarity:78/193 - (40%) Gaps:55/193 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNS 155
            |.|..||.:.|.|..||..|..||||.||||.:...|:|..|::||:.|:       .|:|:|  
Mouse   126 RYCDRCQLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFL-------AYSLLY-- 181

  Fly   156 IYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTN-----------MYLVF----YSLNILALAY 205
                            .|.:|...|.... .||||           |:|.|    :|:::.:   
Mouse   182 ----------------CLFIAATDLQYFI-RFWTNGLPDTQAKFHIMFLFFAAAMFSVSLSS--- 226

  Fly   206 GVLLLAYHVPIVLRGGVSAD-------RTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRS 261
               |..||..:|.:...:.:       |....|..:..|..:|:|.|||:.... ||.|:..|
Mouse   227 ---LFGYHCWLVSKNKSTLEAFRNPVFRHGTDKNGFSLGFSKNMRQVFGDEKKY-WLLPVFSS 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 40/141 (28%)
Zdhhc2NP_848482.1 DHHC 126..247 CDD:366691 41/152 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 296..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000269|PubMed:21471008 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000269|PubMed:28768144 334..335
NPxY-like endocytic signal. /evidence=ECO:0000269|PubMed:28768144 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.