DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc18

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_006539081.1 Gene:Zdhhc18 / 503610 MGIID:3527792 Length:407 Species:Mus musculus


Alignment Length:234 Identity:60/234 - (25%)
Similarity:98/234 - (41%) Gaps:52/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIIAVFLPVVFMFEIVVVL-PAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVE 82
            |.|.:...::|.|.:..:| .:|.:| |.....|...|..|.          ..||.:.:.....
Mouse   114 LAIPIIAAILFFFVMSCLLQTSFTDP-GILPRATICEAAALE----------KQIDNTGSSTYRP 167

  Fly    83 PP--------SDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGF 139
            ||        ...:..:.|..|:...|||:.||..|..|:.:.||||.:.|.|:|.||:|||..|
Mouse   168 PPRTREVMINGQTVKLKYCFTCKMFRPPRTSHCSVCDNCVERFDHHCPWVGNCVGRRNYRFFYAF 232

  Fly   140 IFYL--FVGSVYALVYNSIYMWVIHGHIYSNWVTVL-KLACPMLHLVTGSFWTNMYLVFYSL-NI 200
            |..|  ....::|.|...:.: :..|   ||:::.| |....:|.||         :.|:|: :|
Mouse   233 ILSLSFLTAFIFACVVTHLTL-LSQG---SNFLSALKKTPASVLELV---------ICFFSIWSI 284

  Fly   201 LALAYGVLLLAYHVPIV---------LRGGVSADRTKES 230
            |.|:      .:|..:|         ::|..|:.|..|:
Mouse   285 LGLS------GFHTYLVASNLTTNEDIKGSWSSKRGGEA 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 41/139 (29%)
Zdhhc18XP_006539081.1 DHHC 183..306 CDD:366691 41/141 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.