DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and zdhhc15a

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001006003.1 Gene:zdhhc15a / 449833 ZFINID:ZDB-GENE-041010-87 Length:328 Species:Danio rerio


Alignment Length:192 Identity:57/192 - (29%)
Similarity:85/192 - (44%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFY------LFVGSVY 149
            |.|..||.:.|.|..||..|:.|:||.||||::...|:|..|::|||.|:.|      |.|.:|.
Zfish   123 RFCHHCQLIKPDRCHHCSVCQTCVLKMDHHCLWLNNCMGFSNYKFFMLFLLYSLLYCLLIVSTVT 187

  Fly   150 ALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYH- 213
            ..|   |.:|  .|.::.        :|..||::   |.|.:..:|.......|.:.:.||..: 
Zfish   188 PTV---IQLW--RGRLFD--------SCVELHVL---FLTLVSAIFAITLCFLLIFHIWLLTSNK 236

  Fly   214 -------VPIVLRGGVSADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRSDLPEDGY 268
                   ||..:.|        ...:.:|.||..|...|||.:..| ||.|:..|:  .||:
Zfish   237 TTLEWLSVPFFVNG--------PGSKAFDVGVQANFLQVFGKKKRL-WLFPVFSSE--GDGH 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 41/140 (29%)
zdhhc15aNP_001006003.1 DHHC 123..243 CDD:366691 40/135 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.