DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and zdhhc23b

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001003757.1 Gene:zdhhc23b / 445301 ZFINID:ZDB-GENE-040808-13 Length:425 Species:Danio rerio


Alignment Length:177 Identity:47/177 - (26%)
Similarity:77/177 - (43%) Gaps:44/177 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 NWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVY--AL 151
            ||  |..|:.:.|.|:.||:.|.||:|:.||||::...|:||.|||.|:..:.:..:.|::  :|
Zfish   247 NW--CAVCKVVRPRRAGHCRICGVCVLRLDHHCVWINSCVGLANHRTFLLTLLFFLLTSIFGISL 309

  Fly   152 VYNSI-----------YMWVIHGHIYSNWVTVLKLACPML-HLVTGSFWTNMYLVFYSLNILALA 204
            |..|:           |.    ..:||.:.:.|...|... .:|||..          |::|.|.
Zfish   310 VLASVCPDQRVLTALFYC----PDVYSQYSSALCFTCAWYSSIVTGGL----------LHLLLLQ 360

  Fly   205 YGVLLLAYHVPIVLRGGVSADRTKESKEK----------YDRGVYQN 241
                :|...:.:..|....|.|.|.::.:          |.||.:.|
Zfish   361 ----ILNISLNVTEREARLALREKSAQRRLWGLIVHTGHYSRGFWSN 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 37/140 (26%)
zdhhc23bNP_001003757.1 7TMR-DISM_7TM <62..179 CDD:284997
zf-DHHC <244..>350 CDD:303066 32/108 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.