DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and CG17195

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:281 Identity:94/281 - (33%)
Similarity:140/281 - (49%) Gaps:26/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SNPMPSRMVDILCFL-IIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIA 68
            :|..|...|.|:..| |:.|.....|.|.:.:...|....|...:...:::..|:..||.|||:|
  Fly    12 ANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQMFYIAPKVFGDIAYKLYWILVTFITHNILGNMLA 76

  Fly    69 CMMIDTSVNV----KKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIG 129
            |.|..:|||.    .:...|.|:..|..|..|:||..||||||..|..|||:||||||:||.|||
  Fly    77 CYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILRRDHHCIFTGTCIG 141

  Fly   130 LRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTN---- 190
            ..|.|||..|.|||.:|.|.:  :.:..|:::     .|....:.|:..:.:|:|.:|:.|    
  Fly   142 HNNQRFFFWFTFYLTLGLVTS--FATFCMFIL-----QNGGNFMSLSSVIFNLITRTFFQNYTGN 199

  Fly   191 -MYLVFYSLNILALAYGVLLLAYHVPIVLRGGV---SADRTKESKEKYDRGVYQNLRSVFGNRMH 251
             ...:.:.|||.|......:|||.:.|:.:...   ..|.|      ||.|..:|.:::.|.|..
  Fly   200 TFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCT------YDLGFRKNCQTIMGQRGL 258

  Fly   252 LAWLSPLIRSDLPEDGYHWNV 272
            ..::|||::|.||.||.||.:
  Fly   259 WTFISPLLKSPLPHDGAHWQM 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 50/131 (38%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 50/137 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469549
Domainoid 1 1.000 42 1.000 Domainoid score I12426
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.900

Return to query results.
Submit another query.