DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and CG5196

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_650191.1 Gene:CG5196 / 41522 FlyBaseID:FBgn0038039 Length:427 Species:Drosophila melanogaster


Alignment Length:271 Identity:65/271 - (23%)
Similarity:92/271 - (33%) Gaps:86/271 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVEP--PSDQLNWRECGECQKLAPPRSWHC 107
            ||.|...||:...|.   ..|.:...:....:..|:..|  |.|....:.|.:|:....|||.||
  Fly    46 GFAHQALFLLLSTLA---TFNYVMATLTGPGLMPKQWHPKDPKDAQFLQYCKKCEGYKAPRSHHC 107

  Fly   108 KACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTV 172
            :.|..|:.|.||||.:...|:|..||.:|..|:.:..:||:...|.                   
  Fly   108 RKCDRCVKKMDHHCPWINHCVGWANHAYFTYFLLFSILGSLQGTVV------------------- 153

  Fly   173 LKLACPMLHLVTGSFWTNMYLVFYSLNILA--------------------LAYGV-----LLLAY 212
              |.|        |||..:|..:|..:.||                    ||.||     :||..
  Fly   154 --LCC--------SFWRGIYRYYYLTHGLAHLASVQFTLLSIIMCILGMGLAIGVVIGLSMLLFI 208

  Fly   213 HVPIVLRG--GV--------------SADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRS 261
            .:..::..  |:              :||...|....||.|...|||.||.:.....        
  Fly   209 QLKTIVNNQTGIEIWIVEKAIYRRYRNADCDDEFLYPYDLGWRANLRLVFNDECQKR-------- 265

  Fly   262 DLPEDGYHWNV 272
               .||..|.|
  Fly   266 ---GDGIEWPV 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/151 (25%)
CG5196NP_650191.1 zf-DHHC 89..223 CDD:279823 39/162 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.