DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and CG4483

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:276 Identity:58/276 - (21%)
Similarity:102/276 - (36%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 IIAVFLPVVFMFEIVVVLPAFHEPGGFFHT-FTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVEP 83
            |..:.|.::..:.::.:...:..||....: ..:.:.....|....|.|..:|:.......|..|
  Fly    18 ITLLTLTLIVTWTVIHMNSMWWAPGSSLESVLNYALIWIQTFGTLYNFIRSLMVGPGFVPLKWHP 82

  Fly    84 --PSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVG 146
              ..|::..:.|..|.....|||.||:.|..|::|.||||.:...|:|..|...|:.|:.:...|
  Fly    83 QLTKDKMFLQFCTRCNGYKAPRSHHCRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSG 147

  Fly   147 SVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSF-WTNMYLVFYSLNIL--ALAYGVL 208
            |::..:.  |...||.| |...|:    :...:.|:.|... .||:....:||.::  .:...:.
  Fly   148 SIHGGII--IVSAVIRG-IKKRWL----IRYGLRHMATVHLTQTNLLACVFSLGVIMGTVLASIK 205

  Fly   209 LLAYHVPIVLRGGVSADRTKESKEKYDRGVY-----------------QNLRSVFGNRMHLAWLS 256
            ||...:..:|:.....:.....|..:.|..|                 .|:|.||.:        
  Fly   206 LLYMQMKSILKNQTEIENWIVKKAAFRRNAYPRKGIKPFVYPYNLGWKTNMREVFFS-------- 262

  Fly   257 PLIRSDLPEDGYHWNV 272
                   ..||..|.|
  Fly   263 -------TGDGISWPV 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 36/129 (28%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 36/142 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467514
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.