DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc12

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001013257.1 Gene:Zdhhc12 / 366014 RGDID:1306593 Length:267 Species:Rattus norvegicus


Alignment Length:247 Identity:62/247 - (25%)
Similarity:103/247 - (41%) Gaps:57/247 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNM---IACMMID----TSVNVKKVEPP 84
            |:|:.:  ..|..:.|.|..|...|||:.      :.|::   :|..::|    |:....:.||.
  Rat    27 VLFLHD--TELRQWEEQGELFLPLTFLLL------VLGSLLLYLAVSLMDPGYVTAQPQPQEEPK 83

  Fly    85 SDQ-------LNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFY 142
            .:|       :..|.|..|..|.|.|:.||:.|:.|:.:.||||.:...|:|.|||..|:.::..
  Rat    84 EEQTAMVPQAIPLRRCRYCLVLQPLRARHCRECRRCVRRYDHHCPWMENCVGERNHPLFVAYLAL 148

  Fly   143 LFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTN----MYLVFYSLNILAL 203
            ..|          :.:|    .:|..| :.|:...|.      ..|..    ::..|..|:..||
  Rat   149 QLV----------VLLW----GLYLAW-SGLQFFQPW------GLWLRSTGLLFTTFLLLSFFAL 192

  Fly   204 AYGVLLLAYHVPIVLRGG-----VSADR----TKESKEKYDRGVYQNLRSVF 246
            ... ||||.|:.:|.|..     :|:.|    .:.:...:|||..:||...|
  Rat   193 VVS-LLLASHLYLVARNTTTWEFISSHRIAYLRQRTSNPFDRGPTRNLAHFF 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 36/130 (28%)
Zdhhc12NP_001013257.1 DHHC <123..217 CDD:396215 28/115 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.