DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and spe-10

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001021339.1 Gene:spe-10 / 3565514 WormBaseID:WBGene00004964 Length:351 Species:Caenorhabditis elegans


Alignment Length:208 Identity:53/208 - (25%)
Similarity:91/208 - (43%) Gaps:40/208 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 KKVEPPSDQL-NWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFY 142
            |.|....||: ..:.|.||..:.|.|:.||.:|..|.:|.||||.:...|:...|:::|:.:|.|
 Worm   141 KVVVAECDQVGRLKYCYECGHIKPDRARHCSSCGKCCIKYDHHCPWINMCVTHVNYKYFLLYIIY 205

  Fly   143 LFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMY--LVFYSLNIL---A 202
                 ...|||               |..:..|...:.:.:... ||:..  .:||..:.:   .
 Worm   206 -----TSFLVY---------------WYLLTSLEGAVRYFINQQ-WTDELGKFLFYLFSFIVGGV 249

  Fly   203 LAYGVL--LLAYHVPIVLRGGVSADRTK------ESKEKYDRGVYQNLRSVFGNRMHLAWLSPLI 259
            ..|..|  |:.:|..::.....:.::||      ::...|:.|.|.|.:||||..:   ||.|:.
 Worm   250 FGYYPLGELIIFHYQLISLNETTVEQTKPALLRFDNAADYNMGKYNNFQSVFGWGL---WLCPID 311

  Fly   260 RSDLPEDGYHWNV 272
            .|  .:||.|:::
 Worm   312 SS--TQDGLHFDI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 32/133 (24%)
spe-10NP_001021339.1 zf-DHHC 151..277 CDD:279823 32/146 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.