DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Dnz1

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster


Alignment Length:259 Identity:70/259 - (27%)
Similarity:110/259 - (42%) Gaps:56/259 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 VVFMFEIVVVLP-----AFHEPGGFFHTFTFLMAMF---LVFNIKGNM-IACMMIDTS---VNVK 79
            ||..:.|:..:|     :||..  .|:|..||:||.   .||:..|.: :....:|.|   ...|
  Fly    26 VVIRWIILTTMPGSLWMSFHVV--LFNTVVFLLAMSHSKAVFSDPGTVPLPANRLDFSDLHTTNK 88

  Fly    80 KVEPPSD--QLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFY 142
            ...||.:  ...|..|..|:...|||:.||:.||.||.:.||||.:...|:|.||.::|:.|:.|
  Fly    89 NNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIY 153

  Fly   143 LFVGSVYALVYNSIYMWVIHGHIYSNWV--------TVLKLACPMLHLVTGSFWTNMYLVFYSLN 199
            :.:.|:|::..           |..:||        .|::....|:|.|.             |.
  Fly   154 VALLSLYSIAL-----------IVGSWVWPCEECSQNVIETQLRMIHSVI-------------LM 194

  Fly   200 ILALAYGVLLLAYHVPIVLRGGVSADRTK----ESKEKY--DRGVYQNLRSVFGNRMHLAWLSP 257
            :::..:|:.:.|..|..:  ..:..|.|.    :.|..|  :|..||.|..|||......||.|
  Fly   195 LVSALFGLFVTAIMVDQL--HAILYDETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/134 (26%)
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/156 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467571
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.