DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:284 Identity:60/284 - (21%)
Similarity:106/284 - (37%) Gaps:73/284 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LIIAVFLPVVFMFEIVVVLPAF---HEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNV-- 78
            ||:.|:|..:.:...:|:.|.:   |.||            .|:....|..|.|::.....::  
Human    19 LIVFVWLYNIVLIPKIVLFPHYEEGHIPG------------ILIIIFYGISIFCLVALVRASITD 71

  Fly    79 -------KKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFF 136
                   .|: |..::..|..|.:|..:.|.||.||..|..|:.:.||||.:...|:|..||..|
Human    72 PGRLPENPKI-PHGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLF 135

  Fly   137 MGFIFYLFVGSVYALVYNSIYMWV--------IHGHIYSNWVTVLKLAC----PMLHLVTGSFWT 189
            :...||..:.:.|||:::..:.:.        :...::.:.:.:::||.    .||..:||.|:|
Human   136 LQLCFYTELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLVGITGLFYT 200

  Fly   190 NMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSADRTK--------ESKEKYDRGVYQNLRSVF 246
            .:.                            |:..|.|.        |...:..:...|....||
Human   201 QLI----------------------------GIITDTTSIEKMSNCCEDISRPRKPWQQTFSEVF 237

  Fly   247 GNRMHLAWLSPLIRSDLPEDGYHW 270
            |.|..:.|..|..:.......||:
Human   238 GTRWKILWFIPFRQRQPLRVPYHF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 31/138 (22%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.