DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and pfa5

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:208 Identity:53/208 - (25%)
Similarity:86/208 - (41%) Gaps:55/208 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNS 155
            |.||.|:...|.||.|.:....||.|.||:|.:.|..:...|.:||..|:||.|..:...|:..:
pombe   113 RMCGTCKCWLPDRSHHSRVSMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFYGFSAACMVLISTA 177

  Fly   156 IYMWVIHGH--IYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVL 218
            |.:...:.:  :...|:.|                    |||.:..:|.|  ||:|:.:...::|
pombe   178 IMISRTYHYRSLPGTWIFV--------------------LVFSAFGVLFL--GVMLVRHTGYLLL 220

  Fly   219 RGGVSADRTKESKEK--------------------------YDRGVYQNLRSVFGNRMHLAWLSP 257
              .:::...|..|.:                          :|||..:|.|:|.|:..: .|:.|
pombe   221 --NINSHEAKNWKTRIYSFSVFFPEHMDSRVLVQSDPGDLPWDRGYSENWRAVMGDHWY-NWILP 282

  Fly   258 LIRSDLPEDGYHW 270
            |.||  |.||.|:
pombe   283 LRRS--PGDGEHF 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/128 (27%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 45/194 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.