DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001013141.1 Gene:Zdhhc4 / 304291 RGDID:1308389 Length:343 Species:Rattus norvegicus


Alignment Length:260 Identity:58/260 - (22%)
Similarity:94/260 - (36%) Gaps:58/260 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNVKKV 81
            |.|:..|.|.|..:|   ..|.....||....|...|:.....|:                  :|
  Rat   100 CLLLPYVLLSVNLVF---FTLTCSTNPGTITKTNVLLLLQVYEFD------------------EV 143

  Fly    82 EPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVG 146
            ..|.:.    .|..|....|.||.||:.|..|:.:.||||::...|||..|..:|:.::..|...
  Rat   144 MFPKNS----RCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLLTLTAS 204

  Fly   147 SVYALVYNSIYM--WVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGV-- 207
            :....:.::.::  .|...::|..  |.|........:.||....:::|.|..: |..|.:.:  
  Rat   205 AATIAILSAAFLLRLVAVSNLYQE--TYLDDLGRFQAVDTGFLIQHLFLAFPRI-IFLLGFVIVL 266

  Fly   208 -LLLAYHVPIVLRGGVSADRTKE-------------------SKEK------YDRGVYQNLRSVF 246
             ||||.::...|....:...|.|                   |.|.      |..|::.||:.||
  Rat   267 SLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQHWPLVAWSPSAEPQIHQNIYSHGLWSNLQEVF 331

  Fly   247  246
              Rat   332  331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/131 (26%)
Zdhhc4NP_001013141.1 zf-DHHC 151..292 CDD:279823 36/143 (25%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.