DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc9

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001034105.2 Gene:Zdhhc9 / 302808 RGDID:1561389 Length:364 Species:Rattus norvegicus


Alignment Length:147 Identity:43/147 - (29%)
Similarity:72/147 - (48%) Gaps:17/147 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAVFLPVVFMFEIVVVL-PAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNVKKVEPP 84
            |.||..::|:|.:..:| .:|.:||........ .|.|:...|:..       :.:|...:..||
  Rat    68 IPVFAAMLFLFSMATLLRTSFSDPGVIPRALPD-EAAFIEMEIEAT-------NGAVPQGQRPPP 124

  Fly    85 ---SDQLN-----WRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIF 141
               :.|:|     .:.|..|:...|||:.||..|..|:.:.||||.:.|.|:|.||:|:|..||.
  Rat   125 RIKNFQINNQIVKLKYCYTCKIFRPPRASHCSICDNCVERFDHHCPWVGNCVGKRNYRYFYLFIL 189

  Fly   142 YLFVGSVYALVYNSIYM 158
            .|.:.::|...:|.:|:
  Rat   190 SLSLLTIYVFAFNIVYV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 26/66 (39%)
Zdhhc9NP_001034105.2 zf-DHHC 138..261 CDD:279823 26/69 (38%)
ANXA2R <284..>343 CDD:292349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.