DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:288 Identity:74/288 - (25%)
Similarity:117/288 - (40%) Gaps:82/288 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RMVDILC---FLIIAVFLPVVFMFEIVVVLPAFHE--------PGGFFHTFTFLMAMFLVFNIKG 64
            |:::::.   ||.|::   |.|:.::.:.||:..|        .....|...||   ||..|..|
  Rat     5 RLLNVVAPAYFLCISL---VTFVLQLFLFLPSMREDPTATPLFSPAVLHGALFL---FLSANALG 63

  Fly    65 NMIACMMIDTSVNVKKVEPPSDQLNWRECGECQKLA------PPRSWH-CKACKVCILKRDHHCI 122
            |.|  :::..|        |.|      .|.||..:      ||.|.| |:.|....|:.||||.
  Rat    64 NYI--LVVQNS--------PDD------LGACQGTSSQRPQRPPPSTHFCRVCARVTLRHDHHCF 112

  Fly   123 YTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSF 187
            :||.|||.||.|.|:.|..|..:..:|::|         .|..|.:.|..:..|.|:..|   :.
  Rat   113 FTGNCIGSRNMRNFILFCLYTSLACLYSMV---------AGVAYISAVLSISFAHPLAFL---TL 165

  Fly   188 WTNMYLVFYSLNILALAYGVLLLAY---------------HVPIVLRGGVSADRTKESKEKYDRG 237
            .......|:|..:|.....|:|:.|               .:.::|||        :::.:..:|
  Rat   166 LPTSISQFFSGAVLGSDMFVILMLYLWFAVGLACAGFCCHQLLLILRG--------QTRYQVRKG 222

  Fly   238 V-------YQNLRSVFGNRMHLAWLSPL 258
            |       .:||:.|||.|..|..|.|:
  Rat   223 VAVRARPWRKNLQEVFGKRWLLGLLVPM 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 40/148 (27%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 38/146 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.