DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and ZDHHC1

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens


Alignment Length:282 Identity:71/282 - (25%)
Similarity:115/282 - (40%) Gaps:58/282 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RIRSN-----PMPSRMVDILCFLIIAVFLPVVFMFEIVV-VLPAFHEPGGFFHTFTFLMAMF--- 57
            |.|.|     |.|.::|..|.:|..|     |..|.|:| :||....|.|    :..:.|:|   
Human    38 RSRRNGWSWPPHPLQIVAWLLYLFFA-----VIGFGILVPLLPHHWVPAG----YACMGAIFAGH 93

  Fly    58 LVFNIKGNMIACMMIDTSVNVKKVEPPSDQLNWRE---------CGECQKLAPPRSWHCKACKVC 113
            ||.::  ..::....|.:|..|....|....|..:         |..|......||.||.||..|
Human    94 LVVHL--TAVSIDPADANVRDKSYAGPLPIFNRSQHAHVIEDLHCNLCNVDVSARSKHCSACNKC 156

  Fly   114 ILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACP 178
            :...||||.:...|:|.||:|.|:..:....:| |..||..:.|::|      ..:|..::|...
Human   157 VCGFDHHCKWLNNCVGERNYRLFLHSVASALLG-VLLLVLVATYVFV------EFFVNPMRLRTN 214

  Fly   179 MLHLVTGSFWTNMYLVF--------YSLNILALA-----YGVL-------LLAYHVPIVLRGGVS 223
            . |.......|:::.||        .:..|||||     .|:|       ||.:|:.::.....:
Human   215 R-HFEVLKNHTDVWFVFLPAAPVETQAPAILALAALLILLGLLSTALLGHLLCFHIYLMWHKLTT 278

  Fly   224 ADRTKESKEKYD-RGVYQNLRS 244
            .:...:.:...: :||::.|.|
Human   279 YEYIVQHRPPQEAKGVHRELES 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 41/146 (28%)
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 67/251 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41 1/2 (50%)
zf-DHHC 129..284 CDD:307600 41/162 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.