DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001034348.1 Gene:Zdhhc19 / 288045 RGDID:1309014 Length:359 Species:Rattus norvegicus


Alignment Length:231 Identity:59/231 - (25%)
Similarity:93/231 - (40%) Gaps:43/231 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMID--TSVNVKKVEPPSDQLNWRECGECQK 98
            |.||...|   ....||...:.|.|:..|.:....:.:  .:|:|.:|...:.:|.|  |.:|..
  Rat    63 VFPAVTGP---LFILTFFSLVSLNFSDPGILHRGSVSEDPRTVHVVRVNQRAFRLEW--CPKCLF 122

  Fly    99 LAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHG 163
            ..|||::||..|.:|:...||||.:...|||.||.|.|:..|.:|.:.|...||  :..|::|| 
  Rat   123 HRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFVLLILFLCLYSGALLV--TCLMFLIH- 184

  Fly   164 HIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVS----- 223
                                      ..:|.|.....:|:...|....:.:|:.|...:.     
  Rat   185 --------------------------TSHLPFSLDKAMAILVAVPAAGFLIPLFLLMLIQALSVS 223

  Fly   224 -ADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPL 258
             |:|:.|||.: |...|......|....:|...:||
  Rat   224 RAERSYESKCR-DHEEYNPFDQGFAKNWYLTMCAPL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 34/126 (27%)
Zdhhc19NP_001034348.1 zf-DHHC 112..230 CDD:279823 38/148 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.