DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc19

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_955013.1 Gene:Zdhhc19 / 245308 MGIID:2682948 Length:347 Species:Mus musculus


Alignment Length:197 Identity:51/197 - (25%)
Similarity:79/197 - (40%) Gaps:52/197 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 SVNVKKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGF 139
            :|:|.:|...:.:|.|  |.:|....|||::||..|.:|:...||||.:...|||.||.|.||..
Mouse    98 TVHVVRVNQRAFRLEW--CPKCLFHRPPRTYHCPWCNICVEDFDHHCKWVNNCIGHRNFRLFMLL 160

  Fly   140 IFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALA 204
            :..|.                    :||.   .|.:.|     :|..|.|. :|.|.....:|:.
Mouse   161 VLSLC--------------------LYSG---ALLVTC-----LTFLFRTR-HLPFSLDKGMAIL 196

  Fly   205 YGVLLLAYHVP---IVLRGGVSADRTKESKEK----------YDRGVYQNLRSVFGNRMHLAWLS 256
            ..|....:.:|   ::|...:|..|.:.|.|.          :|:|        |....:||..:
Mouse   197 VAVPAAGFLIPLFLLLLIQALSVSRAESSYESKCRYHPEYNPFDQG--------FAKNWYLAMFA 253

  Fly   257 PL 258
            ||
Mouse   254 PL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/129 (27%)
Zdhhc19NP_955013.1 DHHC 109..>181 CDD:366691 29/101 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 275..347
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.