Sequence 1: | NP_611671.1 | Gene: | CG10344 / 37565 | FlyBaseID: | FBgn0034729 | Length: | 278 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_955013.1 | Gene: | Zdhhc19 / 245308 | MGIID: | 2682948 | Length: | 347 | Species: | Mus musculus |
Alignment Length: | 197 | Identity: | 51/197 - (25%) |
---|---|---|---|
Similarity: | 79/197 - (40%) | Gaps: | 52/197 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 SVNVKKVEPPSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGF 139
Fly 140 IFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGSFWTNMYLVFYSLNILALA 204
Fly 205 YGVLLLAYHVP---IVLRGGVSADRTKESKEK----------YDRGVYQNLRSVFGNRMHLAWLS 256
Fly 257 PL 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG10344 | NP_611671.1 | zf-DHHC | 93..220 | CDD:279823 | 35/129 (27%) |
Zdhhc19 | NP_955013.1 | DHHC | 109..>181 | CDD:366691 | 29/101 (29%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 275..347 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |