DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:309 Identity:67/309 - (21%)
Similarity:114/309 - (36%) Gaps:83/309 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 MPSRMVDI--LCFLIIAVFLPVVFMFE----IVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNM 66
            |.:|...:  |..::|.|...:.|.|:    ...:.||....||           .|.|.:.|.:
Mouse    56 MMARQTGVFYLTLILILVTSGLFFAFDCRYLAEKITPAIPVVGG-----------ILFFFVMGTL 109

  Fly    67 IACMMIDTSV-------------------------------NVKKVEPPSDQLNWRECGECQKLA 100
            :.....|..|                               ..|:|......:..:.|..|:...
Mouse   110 LRTSFSDPGVLPRATPDEAADLERQIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFR 174

  Fly   101 PPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHI 165
            |||:.||..|..|:.:.||||.:.|.|:|.||:|||  ::|.|.:..:...::..:...|||...
Mouse   175 PPRASHCSLCDNCVEQFDHHCPWVGNCVGKRNYRFF--YMFILSLSFLTVFIFAFVITHVIHRSQ 237

  Fly   166 YSNWVTVLK-LACPMLHLVTGSFWTNMYLVFYSL-NILALAYGVLLLAYHVPIV---------LR 219
            ...::..|| ....:|..|         :.|:|: :|:.|:      .:|..::         ::
Mouse   238 QKGFLDALKDSPASVLEAV---------ICFFSVWSIIGLS------GFHTYLISSNQTTNEDIK 287

  Fly   220 GGVSADRTKESKEKYDRGVYQNLRSVFGNRMHLAWLSPLIRSDLPEDGY 268
            |..|..|.||:...|..|      ::|.| ..:|...|:..|.:...||
Mouse   288 GSWSNKRGKENYNPYSYG------NIFTN-CCVALCGPISPSLIDRRGY 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/137 (26%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 35/141 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.