DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and dhhc-4

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001023033.1 Gene:dhhc-4 / 191420 WormBaseID:WBGene00014075 Length:405 Species:Caenorhabditis elegans


Alignment Length:311 Identity:69/311 - (22%)
Similarity:126/311 - (40%) Gaps:71/311 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 RMVDILCFLIIAVFLPVV------------FMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNI- 62
            ::.|||....:..|||||            :.:|: .:|...:.|....:.|.|...:.|.:.. 
 Worm    11 KLDDILLKYKLVRFLPVVLVSLATGWGIYAYTYEL-CILSIDNWPQRIIYLFIFYALLILFYTSY 74

  Fly    63 ---------KGNMIACMMIDTSVNVKKVEPPSDQLNW----------------------RECGEC 96
                     |.....|:...:....:.|:....||..                      |.|.:|
 Worm    75 LRTVYTKAWKPPQKYCIEGASKATYESVKDDERQLQLFLSDIARERDLTLLVRGFDHGIRFCDKC 139

  Fly    97 QKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFM-----GFIFYLFVGSVYALVYNSI 156
            ..:.|.||.||..|:.|:||.||||.:...|:...|:::|:     ||||.:::.:  ..:.:.|
 Worm   140 CCIKPDRSHHCSMCEQCVLKFDHHCPWVNNCVNFGNYKYFILFLAYGFIFCIWIAA--TTLPSFI 202

  Fly   157 YMW----VIHGHIYSNWVTVLKLACPMLHLV--TGSFWTNMYLVFYS-LNILALAYGVLLLAYHV 214
            ..|    .::...|.:..:|::.....||.|  .|.| ..::|:|.| :..|:|::   |..||:
 Worm   203 DFWRHEYDMNKKQYDSIDSVIQRNLKHLHTVLSNGRF-PLVFLLFLSCMFSLSLSF---LFFYHL 263

  Fly   215 PIVLRGGVSADR-------TKESKEKYDRGVYQNLRSVFGNRMHLAWLSPL 258
            .:..:...:.:.       .|.:|:.::.|:..|.|.:||:. .|.|..|:
 Worm   264 YLTAKNRTTVESFRAPMIDGKYAKDAFNHGIRANYREIFGSH-PLYWFLPV 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 39/138 (28%)
dhhc-4NP_001023033.1 zf-DHHC 131..274 CDD:279823 40/148 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.