DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and dhhc-11

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_491675.3 Gene:dhhc-11 / 188748 WormBaseID:WBGene00020694 Length:316 Species:Caenorhabditis elegans


Alignment Length:228 Identity:48/228 - (21%)
Similarity:90/228 - (39%) Gaps:59/228 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 ILCFLIIAVFLPVVFMFEIVVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNMIACMMIDTSVNVK 79
            |..:::..:.:|.. |:.:..:||::           |.:|:.:::.:....:..|.|       
 Worm    17 IFSYILSIIMIPAT-MYVVYPILPSY-----------FWIAIPVLYGLIYIQVIYMTI------- 62

  Fly    80 KVEPPSDQLNWRE-----------------------CGECQKLAPPRSWHCKACKVCILKRDHHC 121
             .||.|.:|..:.                       |..|:......:.|||.|..||...||||
 Worm    63 -YEPASSELKEKVKSEHFVRKPYESEAGRHVITNSFCSICEVRTYRETKHCKRCNFCIDDFDHHC 126

  Fly   122 IYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLACPMLHLVTGS 186
            ::...|||.:|:|.|:..:..:.|.|::....:.:        |:.:|:|...... ::.||...
 Worm   127 VWLNNCIGGKNYRPFVVLVICVNVFSMFCFGLSVV--------IFFSWITNSDERA-LIKLVQDK 182

  Fly   187 FWTNMYLVFYSLNILALAYGVL------LLAYH 213
            .:..:..||..: |..:.||||      ||.:|
 Worm   183 DFLKISWVFLCV-ICIIIYGVLSVTTAHLLYFH 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 35/127 (28%)
dhhc-11NP_491675.3 DUF485 14..75 CDD:294756 13/77 (17%)
zf-DHHC 91..231 CDD:279823 35/134 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.