DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and dhhc-10

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_508805.3 Gene:dhhc-10 / 180745 WormBaseID:WBGene00019344 Length:327 Species:Caenorhabditis elegans


Alignment Length:215 Identity:58/215 - (26%)
Similarity:88/215 - (40%) Gaps:54/215 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PSDQLNWRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSV 148
            |:::...:.|..|.|.||.||.||..||:|:|::||||..||.|:||.|.|:||.|:|:..:|..
 Worm   124 PANESGSKFCFTCNKEAPQRSHHCPLCKMCVLRKDHHCFITGACVGLGNQRYFMVFLFWCAIGLT 188

  Fly   149 YALVYNSIYM------WVIHGHIY-------SNWV------------TVLKLACPMLHLVTGSFW 188
            .|:.:...||      |...|.:|       ..|:            |:...|...|....|   
 Worm   189 IAMPHLFFYMNTEVAYWYPFGFVYYIGPIAVVRWILGYVPFSQACFSTLFSFAGASLITAGG--- 250

  Fly   189 TNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSADRTKESKEKYDRGVYQNLRSVFGNRMHLA 253
                  |:.:.:...:.|..:..:| .:.:|.....|         ...:.:.||.|||....|.
 Worm   251 ------FFGMQVYYTSQGYTMYEWH-NLTVRATFLGD---------GENMGERLRLVFGKHWALN 299

  Fly   254 WLSPLIRSDLPEDGYHWNVP 273
            :|.||          .||:|
 Worm   300 FLIPL----------PWNLP 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 43/151 (28%)
dhhc-10NP_508805.3 zf-DHHC 129..270 CDD:279823 43/150 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 82 1.000 Domainoid score I5385
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3153
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR22883
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5808
SonicParanoid 1 1.000 - - X1251
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
98.860

Return to query results.
Submit another query.