DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and dhhc-8

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001370072.1 Gene:dhhc-8 / 176731 WormBaseID:WBGene00012718 Length:471 Species:Caenorhabditis elegans


Alignment Length:247 Identity:58/247 - (23%)
Similarity:93/247 - (37%) Gaps:80/247 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAVFLPVVFMFEIVV---------VLP----AFHEPGGFFHTFTFLMA----MFLVFNIKGNMIA 68
            |:..||....:.:::         :.|    .:|.||      ..|:|    :||:  :..|::.
 Worm     5 ISALLPAAIAWALIIGCSVSFFWFIAPQIWNQWHTPG------LILIAIDVVLFLM--VSSNLLM 61

  Fly    69 CMMIDTSVNVKKV--EPPSD-------------------QLNWRECGECQKLAPPRSWHCKACKV 112
            .|::|.:|:...:  |.|:.                   ::.|  |..|:...||||.||..|..
 Worm    62 AMLLDPAVHPYAIGSEEPTQVDDLRAPLYKNVDINGITVRMKW--CVTCKFYRPPRSSHCSVCNR 124

  Fly   113 CILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWV-----IHGHIYSN---W 169
            ||...||||.:...|:|.||:|:|..|:..|.:..:|.......|:|.     ...||.|.   .
 Worm   125 CIETFDHHCPWVHNCVGKRNYRYFFFFLCSLSIHMMYVFFLCFAYVWSGSDTNARDHILSPPYLC 189

  Fly   170 VTVLKLACPMLHL-VTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRG 220
            ..||...|.:|.: |.|                       |..:|:.:|.||
 Worm   190 AIVLLALCAVLCVPVIG-----------------------LTVFHLVLVARG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/135 (28%)
dhhc-8NP_001370072.1 DHHC 98..228 CDD:396215 41/146 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.