DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and Zdhhc15

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_011245807.1 Gene:Zdhhc15 / 108672 MGIID:1915336 Length:355 Species:Mus musculus


Alignment Length:297 Identity:69/297 - (23%)
Similarity:116/297 - (39%) Gaps:67/297 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VDILCFLIIAVFLPVVFMFEI-----------VVVLPAFHEPGGFFHTFTFLMAMFLVFNIKGNM 66
            |.:|..:::.::....::||:           |:.|..:|....|| .:|:..::|.:.......
Mouse    23 VPVLVIVLVVLWSYYAYVFELCLVTVLSPAEKVIYLILYHAIFVFF-AWTYWKSIFTLPQQPNQK 86

  Fly    67 IACMMIDTSVNVKKVEPPSDQLNW-------------------RECGECQKLAPPRSWHCKACKV 112
            ......|.. ..|..|.|..|...                   |.|..|..:.|.|..||..|.:
Mouse    87 FHLSYTDKE-RYKNEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIKPDRCHHCSVCAM 150

  Fly   113 CILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIYMWVIHGHIYSNWVTVLKLAC 177
            |:||.||||.:...|||..|::||:.|           |.|:.:|...|...::|.::...:...
Mouse   151 CVLKMDHHCPWVNNCIGFSNYKFFLQF-----------LAYSVLYCLYIATTVFSYFIKYWRGEL 204

  Fly   178 PML----HLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPIVLRGGVSAD-------RTKESK 231
            |.:    |::...|...|:  |.||        |:|..||..:|.|...:.:       .:...|
Mouse   205 PSVRSKFHVLFLLFVACMF--FVSL--------VILFGYHCWLVSRNKTTLEAFCTPVFTSGPEK 259

  Fly   232 EKYDRGVYQNLRSVFGNRMHLAWLSPLIRSDLPEDGY 268
            ..::.|..:|::.|||:.... ||.|:..|  |.||:
Mouse   260 NGFNLGFIKNIQQVFGDNKKF-WLIPIGSS--PGDGH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 38/130 (29%)
Zdhhc15XP_011245807.1 DHHC <126..308 CDD:388695 53/192 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.