DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and zdhhc17

DIOPT Version :10

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:XP_002935687.3 Gene:zdhhc17 / 100486328 XenbaseID:XB-GENE-966618 Length:623 Species:Xenopus tropicalis


Alignment Length:162 Identity:49/162 - (30%)
Similarity:76/162 - (46%) Gaps:18/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 CGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLRNHRFFMGFIFYLFVGSVYALVYNSIY 157
            |..|....|.||.||..|..||.|.||||.:.|.|:|..|||:|||::|:|.. .:..::|..|.
 Frog   430 CSTCLIRKPVRSKHCGICNRCIAKFDHHCPWVGNCVGSGNHRYFMGYLFFLLC-MICWMIYGCIS 493

  Fly   158 MWVIH-GHIYSN---WVTVLKLA-C-PMLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYHVPI 216
            .|.|| ...|:.   |..:.::| | |.:      ||..:..||:.:.:     .|||:.....|
 Frog   494 YWGIHCDTTYTKDGFWTYITQIATCSPWM------FWMFLNSVFHLMWV-----AVLLMCQMYQI 547

  Fly   217 VLRGGVSADRTKESKEKYDRGVYQNLRSVFGN 248
            ...|..:.:|....:.|:.:....::.|.|.:
 Frog   548 SCLGITTNERMNARRYKHFKVTTTSIESPFNH 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 DHHC 93..220 CDD:396215 44/132 (33%)
zdhhc17XP_002935687.3 PHA02875 <45..>105 CDD:165206
ANKYR 78..298 CDD:440430
ANK repeat 80..111 CDD:293786
ANK repeat 113..145 CDD:293786
ANK repeat 147..178 CDD:293786
ANK repeat 180..212 CDD:293786
ANK repeat 215..246 CDD:293786
DHHC 429..559 CDD:396215 46/140 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.