DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10344 and pigv

DIOPT Version :9

Sequence 1:NP_611671.1 Gene:CG10344 / 37565 FlyBaseID:FBgn0034729 Length:278 Species:Drosophila melanogaster
Sequence 2:NP_001186989.1 Gene:pigv / 100148642 ZFINID:ZDB-GENE-121116-1 Length:523 Species:Danio rerio


Alignment Length:176 Identity:34/176 - (19%)
Similarity:57/176 - (32%) Gaps:60/176 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 WRECGECQKLAPPRSWHCKACKVCILKRDHHCIYTGCCIGLR-NHRFFMGF----IFYLFVGSVY 149
            |::........|..:...||..:.|......|:|.|  :|.: |.:...||    :|...|.:..
Zfish   349 WKQIPNFILALPVATLGFKALFIYITDNPVFCMYLG--LGEKGNSKKIYGFCNPRVFVYIVHNTV 411

  Fly   150 ALVYNSIYMWV----------------IHGHIYSNWVTVLK-------------------LAC-- 177
            .|::....|.|                :.||:...:..:||                   |.|  
Zfish   412 LLLFGIFCMHVQVLTRFLASSSPVLYWVSGHLLFKYEPLLKEEKLFRSDQTQQKKNHKPGLRCFA 476

  Fly   178 ------P----MLHLVTGSFWTNMYLVFYSLNILALAYGVLLLAYH 213
                  |    ::|..|.|.:|...|.::      ::|..|.||.|
Zfish   477 GMWRNNPVFYLLMHWKTCSIYTQCILGYF------ISYWFLGLALH 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10344NP_611671.1 zf-DHHC 93..220 CDD:279823 33/173 (19%)
pigvNP_001186989.1 PMT_2 23..523 CDD:304453 34/176 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.