DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment qkr58E-2 and AT4G26480

DIOPT Version :9

Sequence 1:NP_001286724.1 Gene:qkr58E-2 / 37562 FlyBaseID:FBgn0022985 Length:416 Species:Drosophila melanogaster
Sequence 2:NP_001320071.1 Gene:AT4G26480 / 828754 AraportID:AT4G26480 Length:308 Species:Arabidopsis thaliana


Alignment Length:281 Identity:79/281 - (28%)
Similarity:126/281 - (44%) Gaps:71/281 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 TGVGGGSAAGTAGAGTG-----VVPTGVSGGTSNGEHENEHNANADGEKAQPAPAV--QKYMQEL 80
            |.:|||:..|..|.|:|     ..|..:|...|..:..|    .:.|.::||:..|  :||:.||
plant     5 TSLGGGAGGGGGGGGSGGGRFVTYPPPLSVPPSAPQSPN----FSGGLRSQPSFLVEQEKYLSEL 65

  Fly    81 MTERSRMENHFPL--------------AVKLIDEAL-------------------ERVQLNG--- 109
            :.||.::....|:              ...|::.||                   .|..:||   
plant    66 LAERHKLTPFLPVLPHVCRLMNQEILRVTTLLENALSQSRFDHPSPLASGGIFQNSRADMNGWAS 130

  Fly   110 RIPTRDQYAD---------------VYQQRTIKLSQKVHVPI-KDKKFNYVGKLLGPKGNSLRRL 158
            :.|:....:.               :..:|||    :|.:|: |...:|:||:||||:||||:|:
plant   131 QFPSERSVSSSPAPNWLNSPGSSSGLIVKRTI----RVDIPVDKYPNYNFVGRLLGPRGNSLKRV 191

  Fly   159 QEETQCKIVILGRFSMKDRAREEELRNSADAKYAHLNLPLHVEVSTIAPPAEAYARVAYALAEIR 223
            :..|.|:::|.||.|:||..:|:.:|....  |.|||.|||:.|....|.....||:..|...:.
plant   192 EASTDCRVLIRGRGSIKDPIKEDMMRGKPG--YEHLNEPLHILVEAELPIEIVDARLMQAREILD 254

  Fly   224 RYLTP--DKHDDIRQEQYREL 242
            ..|||  :.||..:::|.|||
plant   255 DLLTPVEETHDFYKKQQLREL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
qkr58E-2NP_001286724.1 SF1_like-KH 129..244 CDD:239088 46/117 (39%)
AT4G26480NP_001320071.1 STAR_dimer 61..>93 CDD:406848 6/31 (19%)
KH-I 159..259 CDD:412160 41/105 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5176
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11208
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.